FAM195B (MCRIP1) (NM_207368) Human Recombinant Protein

CAT#: TP311513

Recombinant protein of human hypothetical protein LOC348262 (LOC348262), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified MCRIP1 protein (Cat# TP311513). The protein was produced from HEK293T cells transfected with MCRIP1 cDNA clone (Cat# RC211513) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211513 representing NM_207368
  Red=Cloning site Green=Tags(s)
  
  MHGEKSHGRGQAGRQVPLKQQSVSGESQQGARQGAGQSTCYLSSAFLCNGSFPAGSMSLWDPQPKQAFPS
  VLWCSWAGVPGRRTGQRDPRVQERRGDFVSKLGAAVGGEPLALFGPHSWPGMGHRVPGLGAGFLLFAGFA
  LEPWDSYHVVFEGWTIDMRRNEPERTRSLSAPGPL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_997251
• Locus ID: 348262
• UniProt ID: C9JLW8, A0A024R8R5
• Cytogenetics: 17q25.3
• Refseq Size: 2980
• Refseq ORF: 525
• Synonyms: FAM195B; GRAN2; MCRIP
• Summary: The phosphorylation status of MCRIP1 functions as a molecular switch to regulate epithelial-mesenchymal transition. Unphosphorylated MCRIP1 binds to and inhibits the transcriptional corepressor CTBP(s). When phosphorylated by MAPK/ERK, MCRIP1 releases CTBP(s) resulting in transcriptional silencing of the E-cadherin gene and induction of epithelial-mesenchymal transition (PubMed:25728771).[UniProtKB/Swiss-Prot Function]