MBD3L1 (NM_145208) Human Recombinant Protein
CAT#: TP311313
Recombinant protein of human methyl-CpG binding domain protein 3-like 1 (MBD3L1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211313 protein sequence
Red=Cloning site Green=Tags(s) MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRR LQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGIS QLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGCPEKR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660209 |
Locus ID | 85509 |
UniProt ID | Q8WWY6 |
Cytogenetics | 19p13.2 |
Refseq Size | 748 |
Refseq ORF | 582 |
Synonyms | MBD3L |
Summary | This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407947 | MBD3L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407947 | Transient overexpression lysate of methyl-CpG binding domain protein 3-like 1 (MBD3L1) |
USD 436.00 |
|
PH311313 | MBD3L1 MS Standard C13 and N15-labeled recombinant protein (NP_660209) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review