ROMO1 (NM_080748) Human Recombinant Protein
CAT#: TP310655
Recombinant protein of human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210655 protein sequence
Red=Cloning site Green=Tags(s) MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF MAIGMGIRC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_542786 |
Locus ID | 140823 |
UniProt ID | P60602 |
Cytogenetics | 20q11.22 |
Refseq Size | 477 |
Refseq ORF | 237 |
Synonyms | bA353C18.2; C20orf52; MTGM; MTGMP |
Summary | The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. [provided by RefSeq, Nov 2014] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409065 | ROMO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409065 | Transient overexpression lysate of reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
PH310655 | ROMO1 MS Standard C13 and N15-labeled recombinant protein (NP_542786) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review