RAB1B (NM_030981) Human Recombinant Protein
CAT#: TP309927
Recombinant protein of human RAB1B, member RAS oncogene family (RAB1B), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209927 protein sequence
Red=Cloning site Green=Tags(s) MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERF RTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFA DSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112243 |
Locus ID | 81876 |
UniProt ID | Q9H0U4 |
Cytogenetics | 11q13.2 |
Refseq Size | 1955 |
Refseq ORF | 603 |
Summary | Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196]; Alvarez et al., 2003 [PubMed 12802079]).[supplied by OMIM, Jan 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410580 | RAB1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410580 | Transient overexpression lysate of RAB1B, member RAS oncogene family (RAB1B) |
USD 436.00 |
|
PH309927 | RAB1B MS Standard C13 and N15-labeled recombinant protein (NP_112243) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review