PSMD14 (NM_005805) Human Recombinant Protein

CAT#: TP309829L

Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (PSMD14), 1 mg

Product Images

Coomassie blue staining of purified PSMD14 protein (Cat# TP309829). The protein was produced from HEK293T cells transfected with PSMD14 cDNA clone (Cat# RC209829) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209829 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVI
  DVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERA
  VAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN
  ELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDP
  KRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005796
• Locus ID: 10213
• UniProt ID: O00487, A0A140VKF2
• Cytogenetics: 2q24.2
• Refseq Size: 1734
• Refseq ORF: 930
• Synonyms: PAD1; POH1; RPN11
• Summary: This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S proteasome and mediates substrate deubiquitination. A pseudogene of this gene is also located on the long arm of chromosome 2. [provided by RefSeq, Feb 2012]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome