UGT3A1 (NM_152404) Human Recombinant Protein

CAT#: TP309702

Recombinant protein of human UDP glycosyltransferase 3 family, polypeptide A1 (UGT3A1), 20 µg

Product Images

Coomassie blue staining of purified UGT3A1 protein (Cat# TP309702). The protein was produced from HEK293T cells transfected with UGT3A1 cDNA clone (Cat# RC209702) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209702 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVGQRVLLLVAFLLSGVLLSEAAKILTISTLGGSHYLLLDRVSQILQEHGHNVTMLHQSGKFLIPDIKEE
  EKSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIMDSLKNENYD
  LVFVEAFDFCSFLIAEKLVKPFVAILPTTFGSLDFGLPSPLSYVPVFPSLLTDHMDFWGRVKNFLMFFSF
  SRSQWDMQSTFDNTIKEHFPEGSRPVLSHLLLKAELWFVNSDFAFDFARPLLPNTVYIGGLMEKPIKPVP
  QDLDNFIANFGDAGFVLVAFGSMLNTHQSQEVLKKMHNAFAHLPQGVIWTCQSSHWPRDVHLATNVKIVD
  WLPQSDLLAHPSIRLFVTHGGQNSVMEAIRHGVPMVGLPVNGDQHGNMVRVVAKNYGVSIRLNQVTADTL
  TLTMKQVIEDKRYKSAVVAASVILHSQPLSPAQRLVGWIDHILQTGGATHLKPYAFQQPWHEQYLIDVFV
  FLLGLTLGTMWLCGKLLGVVARWLRGARKVKKT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 59 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689617
• Locus ID: 133688
• UniProt ID: Q6NUS8, A8K444, B7Z3N0
• Cytogenetics: 5p13.2
• Refseq Size: 2888
• Refseq ORF: 1569
• Summary: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane