C9orf37 (NM_032937) Human Recombinant Protein
CAT#: TP309409
Recombinant protein of human chromosome 9 open reading frame 37 (C9orf37), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209409 protein sequence
Red=Cloning site Green=Tags(s) MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPS SPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQG PGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116326 |
Locus ID | 85026 |
Cytogenetics | 9q34.3 |
Refseq Size | 1468 |
Refseq ORF | 528 |
Synonyms | AD038; chromosome 9 open reading frame 37; OTTHUMP00000022697 |
Summary | This transcribed locus is thought to be non-coding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409879 | C9orf37 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409879 | Transient overexpression lysate of chromosome 9 open reading frame 37 (C9orf37) |
USD 436.00 |
|
PH309409 | C9orf37 MS Standard C13 and N15-labeled recombinant protein (NP_116326) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review