Selenophosphate synthetase 1 (SEPHS1) (NM_012247) Human Recombinant Protein

CAT#: TP309406

Recombinant protein of human selenophosphate synthetase 1 (SEPHS1), 20 µg

Product Images

Coomassie blue staining of purified SEPHS1 protein (Cat# TP309406). The protein was produced from HEK293T cells transfected with SEPHS1 cDNA clone (Cat# RC209406) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209406 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDT
  CVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKV
  MPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVA
  VHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAK
  QQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQ
  AWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036379
• Locus ID: 22929
• UniProt ID: P49903
• Cytogenetics: 10p13
• Refseq Size: 3275
• Refseq ORF: 1176
• Synonyms: SELD; SPS; SPS1
• Summary: This gene encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. [provided by RefSeq, Sep 2010]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Metabolic pathways, Selenoamino acid metabolism