Glutathione S Transferase alpha 1 (GSTA1) (NM_145740) Human Recombinant Protein
CAT#: TP308750
Recombinant protein of human glutathione S-transferase alpha 1 (GSTA1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208750 protein sequence
Red=Cloning site Green=Tags(s) MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA ILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVL KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE KSLEEARKIFRF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_665683 |
Locus ID | 2938 |
UniProt ID | P08263, A0A140VJK4 |
Cytogenetics | 6p12.2 |
Refseq Size | 1276 |
Refseq ORF | 666 |
Synonyms | GST-epsilon; GST2; GSTA1-1; GTH1 |
Summary | This gene encodes a member of a family of enzymes that function to add glutathione to target electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. This action is an important step in detoxification of these compounds. This subfamily of enzymes has a particular role in protecting cells from reactive oxygen species and the products of peroxidation. Polymorphisms in this gene influence the ability of individuals to metabolize different drugs. This gene is located in a cluster of similar genes and pseudogenes on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407870 | GSTA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY407870 | Transient overexpression lysate of glutathione S-transferase alpha 1 (GSTA1) |
USD 436.00 |
|
PH308750 | GSTA1 MS Standard C13 and N15-labeled recombinant protein (NP_665683) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review