KCNIP1 (NM_014592) Human Recombinant Protein

CAT#: TP308255L

Recombinant protein of human Kv channel interacting protein 1 (KCNIP1), transcript variant 2, 1 mg

Product Images

Coomassie blue staining of purified KCNIP1 protein (Cat# TP308255). The protein was produced from HEK293T cells transfected with KCNIP1 cDNA clone (Cat# RC208255) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208255 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVN
  EDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDG
  YINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQ
  LFQNVM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055407
• Locus ID: 30820
• UniProt ID: Q9NZI2, Q9NZI2-2
• Cytogenetics: 5q35.1
• Refseq Size: 2028
• Refseq ORF: 648
• Synonyms: KCHIP1; VABP
• Summary: This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subunits to form native Kv4 channel complexes. The encoded protein may regulate rapidly inactivating (A-type) currents, and hence neuronal membrane excitability, in response to changes in the concentration of intracellular calcium. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
• Protein Families: Druggable Genome, Ion Channels: Other