OLAH (NM_001039702) Human Recombinant Protein

CAT#: TP308251M

Recombinant protein of human oleoyl-ACP hydrolase (OLAH), transcript variant 2, 100 µg

Product Images

Coomassie blue staining of purified OLAH protein (Cat# TP308251). The protein was produced from HEK293T cells transfected with OLAH cDNA clone (Cat# RC208251) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208251 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEP
  LENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHR
  IPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPSKAVLSCDLTCFVGS
  EDIAKDMEAWKDVTSGNAKIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034791
• Locus ID: 55301
• UniProt ID: Q9NV23
• Cytogenetics: 10p13
• Refseq Size: 1675
• Refseq ORF: 795
• Synonyms: AURA1; SAST; TE2; THEDC1
• Summary: Contributes to the release of free fatty acids from fatty acid synthase (FASN). Has broad substrate specificity, giving rise to a range of free fatty acids with chain lengths between 10 and 16 carbon atoms (C10 - C16).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Fatty acid biosynthesis, Metabolic pathways