Somatostatin (SST) (NM_001048) Human Recombinant Protein

CAT#: TP307601

Recombinant protein of human somatostatin (SST), 20 µg

Product Images

Coomassie blue staining of purified SST protein (Cat# TP307601). The protein was produced from HEK293T cells transfected with SST cDNA clone (Cat# RC207601) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207601 representing NM_001048
  Red=Cloning site Green=Tags(s)
  
  MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEP
  EDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001039
• Locus ID: 6750
• UniProt ID: P61278
• Cytogenetics: 3q27.3
• Refseq Size: 665
• Refseq ORF: 348
• Synonyms: SMST; SST1
• Summary: The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein