Enkephalin (PENK) (NM_006211) Human Recombinant Protein
CAT#: TP307563
Recombinant protein of human proenkephalin (PENK), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207563 protein sequence
Red=Cloning site Green=Tags(s) MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQ LSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFM KKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRY GGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 30.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006202 |
Locus ID | 5179 |
UniProt ID | P01210 |
Cytogenetics | 8q12.1 |
Refseq Size | 1221 |
Refseq ORF | 801 |
Synonyms | enkephalin A; preproenkephalin; proenkephalin |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the pentapeptide opioids Met-enkephalin and Leu-enkephalin, which are stored in synaptic vesicles, then released into the synapse where they bind to mu- and delta-opioid receptors to modulate the perception of pain. Other non-opioid cleavage products may function in distinct biological activities. [provided by RefSeq, Jul 2015] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401880 | PENK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427669 | PENK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401880 | Transient overexpression lysate of proenkephalin (PENK), transcript variant 2 |
USD 436.00 |
|
LY427669 | Transient overexpression lysate of proenkephalin (PENK), transcript variant 1 |
USD 436.00 |
|
PH307563 | PENK MS Standard C13 and N15-labeled recombinant protein (NP_006202) |
USD 3,255.00 |
|
PH327805 | PENK MS Standard C13 and N15-labeled recombinant protein (NP_001129162) |
USD 3,255.00 |
|
TP327805 | Recombinant protein of human proenkephalin (PENK), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review