C10orf88 (NM_024942) Human Recombinant Protein

CAT#: TP307467L

Recombinant protein of human chromosome 10 open reading frame 88 (C10orf88), 1 mg

Product Images

Coomassie blue staining of purified C10orf88 protein (Cat# TP307467). The protein was produced from HEK293T cells transfected with C10orf88 cDNA clone (Cat# RC207467) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207467 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METRTEDGGLTRRPTLASSWDVAGGALTHSLLLTRAGLGPGDFDWEELLAPPAPGQDLVILKRNHNNKDE
  NPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLDDSEHEKIILYKKNLKLESS
  THACKIKLLSFGERQCVFISKVVVHMRSVFANSSTSSPALGSRIDLDKVQTIMESMGSKLSPGAQQLMDM
  VRCQQRNCIPIGEQLQSVLGNSGYKHMIGLQSSSTLGTLNKSSSTPFPFRTGLTSGNVTENLQTYIDKST
  QLPGGENSTKLDECKVMPQNHSFLENDLKNAMASFLPKKVSDNSNIPNSELLPFLQNLCSQVNHLHVGNK
  TECQENITKHGERILGVGMEEQSICSYLEKILSKNMELMEKKLMDYIDQRIHELQEHIDDKIALLLDLLQ
  NPNSPPTGIPLRHYDSGERLSNGER
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079218
• Locus ID: 80007
• UniProt ID: Q9H8K7
• Cytogenetics: 10q26.13
• Refseq Size: 3102
• Refseq ORF: 1335
• Synonyms: PAAT
• Summary: ATPase that regulates mitochondrial ABC transporters ABCB7, ABCB8/MITOSUR and ABCB10 (PubMed:25063848). Regulates mitochondrial ferric concentration and heme biosynthesis and plays a role in the maintenance of mitochondrial homeostasis and cell survival (PubMed:25063848).[UniProtKB/Swiss-Prot Function]