Glutathione Peroxidase 7 (GPX7) (NM_015696) Human Recombinant Protein

CAT#: TP307428M

Recombinant protein of human glutathione peroxidase 7 (GPX7), 100 µg

Product Images

Coomassie blue staining of purified GPX7 protein (Cat# TP307428). The protein was produced from HEK293T cells transfected with GPX7 cDNA clone (Cat# RC207428) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207428 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQL
  QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEP
  TWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056511
• Locus ID: 2882
• UniProt ID: Q96SL4
• Cytogenetics: 1p32.3
• Refseq Size: 1246
• Refseq ORF: 561
• Synonyms: CL683; GPx-7; GPX6; GSHPx-7; NPGPx
• Summary: It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Arachidonic acid metabolism, Glutathione metabolism