C2orf52 (NM_173513) Human Recombinant Protein

CAT#: TP307309

Recombinant protein of human chromosome 2 open reading frame 52 (C2orf52), 20 µg

Product Images

Coomassie blue staining of purified C2orf52 protein (Cat# TP307309). The protein was produced from HEK293T cells transfected with C2orf52 cDNA clone (Cat# RC207309) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207309 representing NM_173513
  Red=Cloning site Green=Tags(s)
  
  MSEAKDNGSRDEVLVPHKNCRKNTTVPGKKGEEKSLAPVFAEKLISPSRRGAKLKDRESHQENEDRNSEL
  DQDEEDKESFCRGFPMSGCELETSCCVCHSTALGERFC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_775784
• Locus ID: 151477
• Cytogenetics: 2q37.1
• Refseq Size: 1299
• Refseq ORF: 324
• Synonyms: C2orf52