TIRAP (NM_001039661) Human Recombinant Protein

CAT#: TP307162

Recombinant protein of human toll-interleukin 1 receptor (TIR) domain containing adaptor protein (TIRAP), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified TIRAP protein (Cat# TP307162). The protein was produced from HEK293T cells transfected with TIRAP cDNA clone (Cat# RC207162) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207162 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLP
  PTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSS
  HCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGRGPDGGFRQVK
  EAVMRYLQTLSWHLLYHGTPEIGVKLETENPCRASDSHKCDKRYRE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034750
• Locus ID: 114609
• UniProt ID: P58753, A0A024R3M4
• Cytogenetics: 11q24.2
• Refseq Size: 2348
• Refseq ORF: 666
• Synonyms: BACTS1; Mal; MyD88-2; wyatt
• Summary: The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleukin 1 receptor (TIR) domain, which is responsible for signal transduction. The protein encoded by this gene is a TIR adaptor protein involved in the TLR4 signaling pathway of the immune system. It activates NF-kappa-B, MAPK1, MAPK3 and JNK, which then results in cytokine secretion and the inflammatory response. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Toll-like receptor signaling pathway