CD94 (KLRD1) (NM_002262) Human Recombinant Protein

CAT#: TP306991

Recombinant protein of human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified KLRD1 protein (Cat# TP306991). The protein was produced from HEK293T cells transfected with KLRD1 cDNA clone (Cat# RC206991) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206991 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRC
  NCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYL
  FPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002253
• Locus ID: 3824
• UniProt ID: Q13241, Q53ZY6
• Cytogenetics: 12p13.2
• Refseq Size: 3258
• Refseq ORF: 537
• Synonyms: CD94
• Summary: Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2017]
• Protein Families: Transmembrane
• Protein Pathways: Antigen processing and presentation, Graft-versus-host disease, Natural killer cell mediated cytotoxicity