E3 SUMO protein ligase PIAS4 (PIAS4) (NM_015897) Human Recombinant Protein

CAT#: TP306748

Recombinant protein of human protein inhibitor of activated STAT, 4 (PIAS4), 20 µg

Product Images

Coomassie blue staining of purified PIAS4 protein (Cat# TP306748). The protein was produced from HEK293T cells transfected with PIAS4 cDNA clone (Cat# RC206748) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206748 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKN
  SEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFN
  MLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPP
  NIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLT
  SSELLQRLKTIGVKHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDA
  VFYLQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA
  ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEEEEEEEEEDED
  EEGPRPKRRCPFQKGLVPAC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 56.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056981
• Locus ID: 51588
• UniProt ID: Q8N2W9, B3KMR4
• Cytogenetics: 19p13.3
• Refseq Size: 1835
• Refseq ORF: 1530
• Synonyms: PIAS-gamma; Piasg; PIASY; ZMIZ6
• Summary: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. Involved in gene silencing. Mediates sumoylation of CEBPA, PARK7, HERC2, MYB, TCF4 and RNF168. In Wnt signaling, represses LEF1 and enhances TCF4 transcriptional activities through promoting their sumoylations. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors
• Protein Pathways: Jak-STAT signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis