TRIM (TRAT1) (NM_016388) Human Recombinant Protein
CAT#: TP306479M
Recombinant protein of human T cell receptor associated transmembrane adaptor 1 (TRAT1), 100 µg
Frequently bought together (1)
Other products for "TRIM"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206479 protein sequence
Red=Cloning site Green=Tags(s) MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMI SEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQL HAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057472 |
Locus ID | 50852 |
UniProt ID | Q6PIZ9 |
Cytogenetics | 3q13.13 |
Refseq Size | 1695 |
Refseq ORF | 558 |
Synonyms | HSPC062; pp29/30; TCRIM; TRIM |
Summary | Stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.