FBXL2 (NM_012157) Human Recombinant Protein
CAT#: TP306390
Purified recombinant protein of Homo sapiens F-box and leucine-rich repeat protein 2 (FBXL2), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206390 protein sequence
Red=Cloning site Green=Tags(s) MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVE NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC VSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHEL VSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTL LARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDN CLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC VIL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036289 |
Locus ID | 25827 |
UniProt ID | Q9UKC9 |
Cytogenetics | 3p22.3 |
Refseq Size | 3000 |
Refseq ORF | 1269 |
Synonyms | FBL2; FBL3 |
Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 12 tandem leucine-rich repeats. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415925 | FBXL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432929 | FBXL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415925 | Transient overexpression lysate of F-box and leucine-rich repeat protein 2 (FBXL2), transcript variant 1 |
USD 436.00 |
|
LY432929 | Transient overexpression lysate of F-box and leucine-rich repeat protein 2 (FBXL2), transcript variant 2 |
USD 436.00 |
|
PH306390 | FBXL2 MS Standard C13 and N15-labeled recombinant protein (NP_036289) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review