GAS2 (NM_177553) Human Recombinant Protein

CAT#: TP305912L

Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 2, 1 mg

Product Images

Coomassie blue staining of purified GAS2 protein (Cat# TP305912). The protein was produced from HEK293T cells transfected with GAS2 cDNA clone (Cat# RC205912) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205912 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL
  AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK
  QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS
  EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK
  TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_808221
• Locus ID: 2620
• UniProt ID: O43903
• Cytogenetics: 11p14.3
• Refseq Size: 2182
• Refseq ORF: 939
• Synonyms: GAS-2
• Summary: The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2017]
• Protein Families: Druggable Genome