CASTOR1 (NM_001037666) Human Recombinant Protein

CAT#: TP305868

Recombinant protein of human hypothetical protein LOC652968 (LOC652968), 20 µg

Product Images

Coomassie blue staining of purified CASTOR1 protein (Cat# TP305868). The protein was produced from HEK293T cells transfected with CASTOR1 cDNA clone (Cat# RC205868) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205868 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQ
  VAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQE
  FDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHS
  TPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGI
  VAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001032755
• Locus ID: 652968
• UniProt ID: Q8WTX7
• Cytogenetics: 22q12.2
• Refseq Size: 1644
• Refseq ORF: 987
• Synonyms: GATSL3
• Summary: Functions as an intracellular arginine sensor within the amino acid-sensing branch of the TORC1 signaling pathway. As a homodimer or a heterodimer with CASTOR2, binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Binding of arginine to CASTOR1 allosterically disrupts the interaction of CASTOR1-containing dimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.[UniProtKB/Swiss-Prot Function]