C20orf11 (GID8) (NM_017896) Human Recombinant Protein

CAT#: TP305664

Recombinant protein of human chromosome 20 open reading frame 11 (C20orf11), 20 µg

Product Images

Coomassie blue staining of purified GID8 protein (Cat# TP305664). The protein was produced from HEK293T cells transfected with GID8 cDNA clone (Cat# RC205664) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205664 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSYAEKPDEITKDEWMEKLNNLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGIEPSLDLETLDERIKI
  REMILKGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEAALEFAQTQLAEQGEESRECL
  TEMERTLALLAFDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKK
  VKYPKMTDLSKGVIEEPK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060366
• Locus ID: 54994
• UniProt ID: Q9NWU2
• Cytogenetics: 20q13.33
• Refseq Size: 4440
• Refseq ORF: 684
• Synonyms: C20orf11; TWA1
• Summary: Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (PubMed:29911972). Acts as a positive regulator of Wnt signaling pathway by promoting beta-catenin (CTNNB1) nuclear accumulation (PubMed:28829046).[UniProtKB/Swiss-Prot Function]