RPL26L1 (NM_016093) Human Recombinant Protein

CAT#: TP305652

Recombinant protein of human ribosomal protein L26-like 1 (RPL26L1), 20 µg

Product Images

Coomassie blue staining of purified RPL26L1 protein (Cat# TP305652). The protein was produced from HEK293T cells transfected with RPL26L1 cDNA clone (Cat# RC205652) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205652 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKV
  VQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELI
  EKMQE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057177
• Locus ID: 51121
• UniProt ID: Q9UNX3
• Cytogenetics: 5q35.1
• Refseq Size: 723
• Refseq ORF: 435
• Synonyms: RPL26P1
• Summary: This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Dec 2015]
• Protein Pathways: Ribosome