SLC35G2 (NM_025246) Human Recombinant Protein
CAT#: TP305536
Recombinant protein of human transmembrane protein 22 (TMEM22), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205536 protein sequence
Red=Cloning site Green=Tags(s) MDTSPSRKYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEGYGNFMEENPKKGLLSEMKKKGRAFFG TMDTLPPPTEDPMINEIGQFQSFAEKNIFQSRKMWIVLFGSALAHGCVALITRLVSDRSKVPSLELIFIR SVFQVLSVLVVCYYEEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILA FLLVDEKMAYVDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKE KISMWTALFTFGWTGTIWGISTMFILQEPIIPLDGETWSYLIAICVCSTAAFLGVYYALDKFHPALVSTV QHLEIVVAMVLQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRRQDYQEILDSPIK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079522 |
Locus ID | 80723 |
UniProt ID | Q8TBE7 |
Cytogenetics | 3q22.3 |
Refseq Size | 2079 |
Refseq ORF | 1236 |
Synonyms | TMEM22 |
Summary | May play a role in cell proliferation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410808 | SLC35G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420393 | SLC35G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420394 | SLC35G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410808 | Transient overexpression lysate of transmembrane protein 22 (TMEM22), transcript variant 1 |
USD 436.00 |
|
LY420393 | Transient overexpression lysate of transmembrane protein 22 (TMEM22), transcript variant 2 |
USD 436.00 |
|
LY420394 | Transient overexpression lysate of transmembrane protein 22 (TMEM22), transcript variant 3 |
USD 436.00 |
|
PH305536 | TMEM22 MS Standard C13 and N15-labeled recombinant protein (NP_079522) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review