HORMAD2 (NM_152510) Human Recombinant Protein

CAT#: TP305453

Recombinant protein of human HORMA domain containing 2 (HORMAD2), 20 µg

Product Images

Coomassie blue staining of purified HORMAD2 protein (Cat# TP305453). The protein was produced from HEK293T cells transfected with HORMAD2 cDNA clone (Cat# RC205453) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATAQLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKI
  LREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSS
  STSFESGTNNEDIKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLL
  FDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFV
  CSQQSSECSRKKRKVSEPVKVFIPNRK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689723
• Locus ID: 150280
• UniProt ID: Q8N7B1
• Cytogenetics: 22q12.2
• Refseq Size: 1909
• Refseq ORF: 921
• Synonyms: CT46.2
• Summary: Essential for synapsis surveillance during meiotic prophase via the recruitment of ATR activity. Plays a key role in the male mid-pachytene checkpoint and the female meiotic prophase checkpoint: required for efficient build-up of ATR activity on unsynapsed chromosome regions, a process believed to form the basis of meiotic silencing of unsynapsed chromatin (MSUC) and meiotic prophase quality control in both sexes. Required for the DNA double-strand break-independent, BRCA1-dependent activation of ATR on the sex chromosomes that is essential for normal sex body formation (By similarity).[UniProtKB/Swiss-Prot Function]