H4-16 (NM_175054) Human Recombinant Protein

CAT#: TP305064

Recombinant protein of human histone cluster 4, H4 (HIST4H4), 20 µg

Product Images

Coomassie blue staining of purified HIST4H4 protein (Cat# TP305064). The protein was produced from HEK293T cells transfected with HIST4H4 cDNA clone (Cat# RC205064) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205064 representing NM_175054
  Red=Cloning site Green=Tags(s)
  
  MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
  VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_778224
• Locus ID: 121504
• UniProt ID: P62805, B2R4R0
• Cytogenetics: 12p12.3
• Refseq Size: 412
• Refseq ORF: 309
• Synonyms: H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4
• Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. [provided by RefSeq, Aug 2015]
• Protein Pathways: Systemic lupus erythematosus