Thymidylate Synthase (TYMS) (NM_001071) Human Recombinant Protein

CAT#: TP304814L

Recombinant protein of human thymidylate synthetase (TYMS), 1 mg

Product Images

Coomassie blue staining of purified TYMS protein (Cat# TP304814). The protein was produced from HEK293T cells transfected with TYMS cDNA clone (Cat# RC204814) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204814 representing NM_001071
  Red=Cloning site Green=Tags(s)
  
  MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDE
  FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWR
  HFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC
  QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLR
  ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001062
• Locus ID: 7298
• UniProt ID: P04818, Q53Y97
• Cytogenetics: 18p11.32
• Refseq Size: 1536
• Refseq ORF: 939
• Synonyms: HST422; TMS; TS
• Summary: Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy. [provided by RefSeq, Aug 2017]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, One carbon pool by folate, Pyrimidine metabolism