PLAC1 (NM_021796) Human Recombinant Protein

CAT#: TP304793M

Purified recombinant protein of Human placenta-specific 1 (PLAC1), with C-terminal MYC/DDK tag, expressed in HEK293 cells, 100 µg

Product Images

Coomassie blue staining of purified PLAC1 protein (Cat# TP304793). The protein was produced from HEK293T cells transfected with PLAC1 cDNA clone (Cat# RC204793) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204793 representing NM_021796
  Red=Cloning site Green=Tags(s)
  
  MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHA
  YQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATA
  QKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIG
  SM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068568
• Locus ID: 10761
• UniProt ID: Q9HBJ0
• Cytogenetics: Xq26.3
• Refseq Size: 1126
• Refseq ORF: 636
• Synonyms: CT92; OOSP2B; OOSP2L
• Summary: May play a role in placental development.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein