HSD17B6 (NM_003725) Human Recombinant Protein
CAT#: TP304701
Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse) (HSD17B6), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204701 protein sequence
Red=Cloning site Green=Tags(s) MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLR GQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIG VIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFR TGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTR YSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003716 |
Locus ID | 8630 |
UniProt ID | O14756, A0A024RB43 |
Cytogenetics | 12q13.3 |
Refseq Size | 1629 |
Refseq ORF | 951 |
Synonyms | HSE; RODH; SDR9C6 |
Summary | The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418477 | HSD17B6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418477 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse) (HSD17B6) |
USD 436.00 |
|
PH304701 | HSD17B6 MS Standard C13 and N15-labeled recombinant protein (NP_003716) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review