HOXB7 (NM_004502) Human Recombinant Protein

CAT#: TP304495

Recombinant protein of human homeobox B7 (HOXB7), 20 µg

Product Images

Coomassie blue staining of purified HOXB7 protein (Cat# TP304495). The protein was produced from HEK293T cells transfected with HOXB7 cDNA clone (Cat# RC204495) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204495 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSLYYANALFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSA
  AGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRG
  RQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAE
  AEEEEEE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004493
• Locus ID: 3217
• UniProt ID: P09629
• Cytogenetics: 17q21.32
• Refseq Size: 1377
• Refseq ORF: 651
• Synonyms: HHO.C1; Hox-2.3; HOX2; HOX2C
• Summary: This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors