MEK6 (MAP2K6) (NM_002758) Human Recombinant Protein

CAT#: TP304481L

Recombinant protein of human mitogen-activated protein kinase kinase 6 (MAP2K6), 1 mg

Product Images

DNA damage activates TAK1. PSC27 cells were treated with bleomycin, an inducer of DNA strand breaks, with or without increasing concentrations of the TAK1 inhibitor 5Z-7. Cell lysates were immunoprecipitated with an anti-p-TAK1 antibody and subjected to the in vitro kinase assay with MKK6 (OriGene TP304481) as a substrate and radio-labeled ATP. Resulting samples were separated on a 12% SDS-PAGE gel and visualized with autoradiography. Figure cited from Nat Commun, PMID: 29712904

• 

  Coomassie blue staining of purified MAP2K6 protein (Cat# TP304481). The protein was produced from HEK293T cells transfected with MAP2K6 cDNA clone (Cat# RC204481) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204481 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKM
  RHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFY
  KQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAK
  TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA
  DKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: In vitro kinase assay substrate (PMID: 29712904)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002749
• Locus ID: 5608
• UniProt ID: P52564, A8K3Y2
• Cytogenetics: 17q24.3
• Refseq Size: 1879
• Refseq ORF: 1002
• Synonyms: MAPKK6; MEK6; MKK6; PRKMK6; SAPKK-3; SAPKK3
• Summary: This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Amyotrophic lateral sclerosis (ALS), Fc epsilon RI signaling pathway, GnRH signaling pathway, MAPK signaling pathway, Toll-like receptor signaling pathway