PGAM1 (NM_002629) Human Recombinant Protein

CAT#: TP304054M

Recombinant protein of human phosphoglycerate mutase 1 (brain) (PGAM1), 100 µg

Product Images

Coomassie blue staining of purified PGAM1 protein (Cat# TP304054). The protein was produced from HEK293T cells transfected with PGAM1 cDNA clone (Cat# RC204054) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204054 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV
  LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR
  RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL
  PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002620
• Locus ID: 5223
• UniProt ID: P18669, Q6FHU2
• Cytogenetics: 10q24.1
• Refseq Size: 1762
• Refseq ORF: 762
• Synonyms: HEL-S-35; PGAM-B; PGAMA
• Summary: The protein encoded by this gene is a mutase that catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways