PMM2 (NM_000303) Human Recombinant Protein

CAT#: TP303472

Recombinant protein of human phosphomannomutase 2 (PMM2), 20 µg

Product Images

Coomassie blue staining of purified PMM2 protein (Cat# TP303472). The protein was produced from HEK293T cells transfected with PMM2 cDNA clone (Cat# RC203472) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203472 representing NM_000303
  Red=Cloning site Green=Tags(s)
  
  MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPE
  NGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEE
  RIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDK
  TMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000294
• Locus ID: 5373
• UniProt ID: O15305, A0A0S2Z4J6, Q59F02
• Cytogenetics: 16p13.2
• Refseq Size: 2302
• Refseq ORF: 738
• Synonyms: CDG1; CDG1a; CDGS; PMI; PMI1; PMM 2
• Summary: The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways