TNFAIP8 (NM_014350) Human Recombinant Protein

CAT#: TP302729

Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, 20 µg

Size: 20 ug 100 ug 1 mg


  View other "TNFAIP8" proteins (8)

USD 867.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
TNFAIP8 mouse monoclonal antibody,clone OTI1H9
    • 100 ul

USD 447.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "TNFAIP8"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC202729 protein sequence
Red=Cloning site Green=Tags(s)

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEK
IIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLH
QIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_055165
Locus ID 25816
UniProt ID O95379
Cytogenetics 5q23.1
Refseq Size 2103
Refseq ORF 594
Synonyms GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2
Summary Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.