C6orf168 (FAXC) (NM_032511) Human Recombinant Protein

CAT#: TP302541

Recombinant protein of human chromosome 6 open reading frame 168 (C6orf168), 20 µg

Product Images

Coomassie blue staining of purified FAXC protein (Cat# TP302541). The protein was produced from HEK293T cells transfected with FAXC cDNA clone (Cat# RC202541) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202541 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSDPWWKKTLYLT
  GGALLAAAAYLLHELLVIRKQQEIDSKDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGK
  LSAQGKMPWIEYNHEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAISRAVTKMVEEHFYWTLAYCQWVDN
  LNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYI
  MGPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDNTIYESEESSE
  GSKTHTPLLDFSFYSRTETFEDEGAENSFSRTPDTDFTGHSLFDSDVDMDDYTDHEQCK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115900
• Locus ID: 84553
• UniProt ID: Q5TGI0
• Cytogenetics: 6q16.2
• Refseq Size: 9773
• Refseq ORF: 1227
• Synonyms: C6orf168; dJ273F20
• Summary: May play a role in axonal development.[UniProtKB/Swiss-Prot Function]