HSD17B12 (NM_016142) Human Recombinant Protein

CAT#: TP302385M

Purified recombinant protein of Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12), with C-terminal Myc/DDK tag, expressed in HEK293 cells, 100 µg

Product Images

Coomassie blue staining of purified HSD17B12 protein (Cat# TP302385). The protein was produced from HEK293T cells transfected with HSD17B12 cDNA clone (Cat# RC202385) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202385 representing NM_016142
  Red=Cloning site Green=Tags(s)
  
  MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEEL
  AKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEY
  PEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERSKGAILNISSGSGMLPVPLLTIYSATKTFVD
  FFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGS
  IISNLPSWIYLKIVMNMNKSTRAHYLKKTKKN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057226
• Locus ID: 51144
• UniProt ID: Q53GQ0
• Cytogenetics: 11p11.2
• Refseq Size: 2556
• Refseq ORF: 936
• Synonyms: KAR; SDR12C1
• Summary: This gene encodes a very important 17beta-hydroxysteroid dehydrogenase (17beta-HSD) that converts estrone into estradiol in ovarian tissue. This enzyme is also involved in fatty acid elongation. [provided by RefSeq, Oct 2011]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Androgen and estrogen metabolism, Biosynthesis of unsaturated fatty acids, Metabolic pathways