GNG11 (NM_004126) Human Recombinant Protein

CAT#: TP302169M

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 11 (GNG11), 100 µg

Product Images

Coomassie blue staining of purified GNG11 protein (Cat# TP302169). The protein was produced from HEK293T cells transfected with GNG11 cDNA clone (Cat# RC202169) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202169 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSC
  VIS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004117
• Locus ID: 2791
• UniProt ID: P61952, Q53Y01
• Cytogenetics: 7q21.3
• Refseq Size: 964
• Refseq ORF: 219
• Synonyms: GNGT11
• Summary: This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling system. This protein is also subject to carboxyl-terminal processing. Decreased expression of this gene is associated with splenic marginal zone lymphomas. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway