STOM (NM_004099) Human Recombinant Protein

CAT#: TP302060

Recombinant protein of human stomatin (STOM), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified STOM protein (Cat# TP302060). The protein was produced from HEK293T cells transfected with STOM cDNA clone (Cat# RC202060) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202060 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEKRHTRDSEAQRLPDSFKDSPSKGLGPCGWILVAFSFLFTVITFPISIWMCIKIIKEYERAIIFRLGR
  ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNAD
  SATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAE
  AEASREARAKVIAAEGEMNASRALKEASMVITEYPAALQLRYLQTLTTIAAEKNSTIVFPLPIDMLQGII
  GAKHSHLG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004090
• Locus ID: 2040
• UniProt ID: P27105, A0A024R882
• Cytogenetics: 9q33.2
• Refseq Size: 3198
• Refseq ORF: 864
• Synonyms: BND7; EPB7; EPB72
• Summary: This gene encodes a member of a highly conserved family of integral membrane proteins. The encoded protein localizes to the cell membrane of red blood cells and other cell types, where it may regulate ion channels and transporters. Loss of localization of the encoded protein is associated with hereditary stomatocytosis, a form of hemolytic anemia. There is a pseudogene for this gene on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
• Protein Families: Transmembrane