GRO alpha (CXCL1) (NM_001511) Human Recombinant Protein

CAT#: TP301992

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) (CXCL1), full length, with C-terminal MYC/DDK tag，expressed in HEK293T cells, 20 ug

Product Images

Coomassie blue staining of purified CXCL1 protein (Cat #TP301992). The protein was produced from mammalian cells transfected with CXCL1 cDNA clone (Cat #RC201992).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201992 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCA
  QTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris.HCl, pH7.3, 100mM glycine, 10% glycerol.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001502
• Locus ID: 2919
• UniProt ID: P09341
• Cytogenetics: 4q13.3
• Refseq Size: 1184
• Refseq ORF: 321
• Synonyms: FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1
• Summary: This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Epithelial cell signaling in Helicobacter pylori infection, NOD-like receptor signaling pathway