NDUFA5 (NM_005000) Human Recombinant Protein

CAT#: TP301539L

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa (NDUFA5), nuclear gene encoding mitochondrial protein, 1 mg

Product Images

Coomassie blue staining of purified NDUFA5 protein (Cat# TP301539). The protein was produced from HEK293T cells transfected with NDUFA5 cDNA clone (Cat# RC201539) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201539 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLED
  QLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004991
• Locus ID: 4698
• UniProt ID: Q16718, A0A024R745
• Cytogenetics: 7q31.32
• Refseq Size: 5602
• Refseq ORF: 348
• Synonyms: B13; CI-13kB; CI-13KD-B; NUFM; UQOR13
• Summary: This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16. [provided by RefSeq, Apr 2014]
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease