RITA (RITA1) (NM_032848) Human Recombinant Protein

CAT#: TP301409L

Recombinant protein of human chromosome 12 open reading frame 52 (C12orf52), 1 mg

Product Images

Coomassie blue staining of purified RITA1 protein (Cat# TP301409). The protein was produced from HEK293T cells transfected with RITA1 cDNA clone (Cat# RC201409) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201409 representing NM_032848
  Red=Cloning site Green=Tags(s)
  
  MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEA
  SKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSEGASFGAPRMAKGDAAKLRAL
  LWTPPPTPRGSHSPRPREAPLRAIHPAGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPST
  GHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_116237
• Locus ID: 84934
• UniProt ID: Q96K30, A0A024RBL1
• Cytogenetics: 12q24.13
• Refseq Size: 1775
• Refseq ORF: 807
• Synonyms: C12orf52; RITA
• Summary: Tubulin-binding protein that acts as a negative regulator of Notch signaling pathway. Shuttles between the cytoplasm and the nucleus and mediates the nuclear export of RBPJ/RBPSUH, thereby preventing the interaction between RBPJ/RBPSUH and NICD product of Notch proteins (Notch intracellular domain), leading to down-regulate Notch-mediated transcription. May play a role in neurogenesis.[UniProtKB/Swiss-Prot Function]