PAFAH1B2 (NM_002572) Human Recombinant Protein

CAT#: TP301313M

Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa (PAFAH1B2), 100 µg

Product Images

Coomassie blue staining of purified PAFAH1B2 protein (Cat# TP301313). The protein was produced from HEK293T cells transfected with PAFAH1B2 cDNA clone (Cat# RC201313) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201313 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN
  FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL
  PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH
  ELIMQLLEETPEEKQTTIA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002563
• Locus ID: 5049
• UniProt ID: P68402, V9HW44
• Cytogenetics: 11q23.3
• Refseq Size: 4200
• Refseq ORF: 687
• Synonyms: HEL-S-303
• Summary: Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2014]
• Protein Pathways: Ether lipid metabolism, Metabolic pathways