UQCRH (NM_006004) Human Recombinant Protein

CAT#: TP301258L

Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein (UQCRH), 1 mg

Product Images

Coomassie blue staining of purified UQCRH protein (Cat# TP301258). The protein was produced from HEK293T cells transfected with UQCRH cDNA clone (Cat# RC201258) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201258 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEE
  LFDFLHARDHCVAHKLFNNLK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005995
• Locus ID: 7388
• UniProt ID: P07919
• Cytogenetics: 1p33
• Refseq Size: 623
• Refseq ORF: 273
• Synonyms: QCR6; UQCR8
• Summary: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease