Mutarotase (GALM) (NM_138801) Human Recombinant Protein
CAT#: TP300995
Recombinant protein of human galactose mutarotase (aldose 1-epimerase) (GALM), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200995 protein sequence
Red=Cloning site Green=Tags(s) MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQP YFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGY PGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIP TGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQF YTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620156 |
Locus ID | 130589 |
UniProt ID | Q96C23, A0A384MDW6 |
Cytogenetics | 2p22.1 |
Refseq Size | 2483 |
Refseq ORF | 1026 |
Synonyms | BLOCK25; GALAC4; GLAT; HEL-S-63p; IBD1 |
Summary | This gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.[provided by RefSeq, Mar 2009] |
Protein Pathways | Glycolysis / Gluconeogenesis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408487 | GALM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408487 | Transient overexpression lysate of galactose mutarotase (aldose 1-epimerase) (GALM) |
USD 436.00 |
|
PH300995 | GALM MS Standard C13 and N15-labeled recombinant protein (NP_620156) |
USD 3,255.00 |
|
TP720250 | Recombinant protein of human galactose mutarotase (aldose 1-epimerase) (GALM) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review