NMNAT2 (NM_170706) Human Recombinant Protein

CAT#: TP300889

Recombinant protein of human nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified NMNAT2 protein (Cat# TP300889). The protein was produced from HEK293T cells transfected with NMNAT2 cDNA clone (Cat# RC200889) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200889 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEIQELEEIQACQGLWEVFVTLSERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSRHRLIMCQLAVQ
  NSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQPQNETPQPIYQNSNVAT
  KPTAAKILGKVGESLSRICCVRPPVERFTFVDENANLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNE
  ADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVV
  DYLSQPVIDYILKSQLYINASG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_733820
• Locus ID: 23057
• UniProt ID: Q9BZQ4
• Cytogenetics: 1q25.3
• Refseq Size: 5467
• Refseq ORF: 906
• Synonyms: C1orf15; PNAT2
• Summary: This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism