CYBC1 (NM_001033046) Human Recombinant Protein
CAT#: TP300883
Recombinant protein of human chromosome 17 open reading frame 62 (C17orf62), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200883 protein sequence
Red=Cloning site Green=Tags(s) MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAI FDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQ SAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028218 |
Locus ID | 79415 |
UniProt ID | Q9BQA9, A0A024R8W9 |
Cytogenetics | 17q25.3 |
Refseq Size | 2167 |
Refseq ORF | 561 |
Synonyms | C17orf62; CGD5; Eros |
Summary | Necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 hetrodimer. Controls the phagocyte respiratory burst and is essential for innate immunity.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420251 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420252 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422350 | C17orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY420251 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 1 |
USD 436.00 |
|
LY420252 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 3 |
USD 436.00 |
|
LY422350 | Transient overexpression lysate of chromosome 17 open reading frame 62 (C17orf62), transcript variant 2 |
USD 436.00 |
|
PH300883 | C17orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028218) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review