POLR2F (NM_021974) Human Recombinant Protein

CAT#: TP300855M

Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide F (POLR2F), 100 µg

Product Images

Coomassie blue staining of purified POLR2F protein (Cat# TP300855). The protein was produced from HEK293T cells transfected with POLR2F cDNA clone (Cat# RC200855) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200855 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRA
  LQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068809
• Locus ID: 5435
• UniProt ID: P61218
• Cytogenetics: 22q13.1
• Refseq Size: 2109
• Refseq ORF: 381
• Synonyms: HRBP14.4; POLRF; RPABC2; RPABC14.4; RPB6; RPB14.4; RPC15
• Summary: This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase