C11orf48 (LBHD1) (NM_024099) Human Recombinant Protein

CAT#: TP300782M

Recombinant protein of human chromosome 11 open reading frame 48 (C11orf48), 100 µg

Product Images

Coomassie blue staining of purified LBHD1 protein (Cat# TP300782). The protein was produced from HEK293T cells transfected with LBHD1 cDNA clone (Cat# RC200782) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200782 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALVPGRSKEDGLWTRNSPGSSQHPESPRLPNPLWDRGKIGKVEGHQHIQDFSQKSHLPSIVVESSEVNE
  ESGDLHLPHEELLLLTDGEEEDAEAFFQDQSEEPGWAWSPQDPRSPLRTFNAGLSWGQDQDEEDACWILE
  DTACLEATNHCPFWDSTGSRVCRSGFVEYSHLLPPNSFEGAEEEAVQTPAGVESGAASEAPGGRGCDRPR
  ADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSPFKASQD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_077004
• Locus ID: 79081
• UniProt ID: Q9BQE6, A0A024R584
• Cytogenetics: 11q12.3
• Refseq Size: 1357
• Refseq ORF: 789
• Synonyms: C11orf48
• Summary: This gene shares three exons in common with another gene, chromosome 11 open reading frame 98 (GeneID:102288414), but the encoded protein uses a reading frame that is different from that of the chromosome 11 open reading frame 98 gene. [provided by RefSeq, Nov 2017]